PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00011.170
Common NameAMTR_s00011p00255340
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family ZF-HD
Protein Properties Length: 243aa    MW: 26943.6 Da    PI: 9.4269
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00011.170genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer99.32.7e-3144100360
                               ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60 
                                               + +Y eClkNhAa++Ggha+DGC+Efmps geeg++++lkCaAC+CHRnFHR+++ee+
  evm_27.model.AmTr_v1.0_scaffold00011.170  44 NSHYGECLKNHAAAIGGHALDGCCEFMPS-GEEGSIESLKCAACNCHRNFHRKDSEEN 100
                                               679*************************9.999********************98865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047703.5E-284697IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015666.5E-294696IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.7174796IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257743.0E-194798IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.601.3E-30168239IPR009057Homeodomain-like
SuperFamilySSF466896.45E-19169238IPR009057Homeodomain-like
TIGRFAMsTIGR015652.2E-27178234IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 243 aa     Download sequence    Send to blast
MPISVGFGPI HQSPTKPAKP THCEARLEPA PPHVSPNPRL KRRNSHYGEC LKNHAAAIGG  60
HALDGCCEFM PSGEEGSIES LKCAACNCHR NFHRKDSEEN SIPQSCLYCY HRSPKAVKSN  120
NHFLPLPSSP QGVIPGPPFS MVAFGPNDSS SEDLHNQVIR PMCVVSKQSN GNKGSDHKRF  180
RTKFTQEQKE RMLGFAERVG WRIQKQDEGA VQRFCDEVGV KRHVLKVWMH NNKNTLGKKS  240
SS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A1e-261782351875ZF-HD homeobox family protein
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011623848.10.0PREDICTED: zinc-finger homeodomain protein 2
SwissprotQ6YXH54e-64ZHD1_ORYSJ; Zinc-finger homeodomain protein 1
SwissprotA2Z2595e-64ZHD1_ORYSI; Zinc-finger homeodomain protein 1
TrEMBLW1NH170.0W1NH17_AMBTC; Uncharacterized protein
STRINGEFJ329773e-63(Selaginella moellendorffii)
STRINGEFJ158523e-63(Selaginella moellendorffii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9116237
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14440.24e-60homeobox protein 31
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]